Element Peptides

Boutique peptide vendor emphasizing small-batch quality control.

What Customers Mention

shippingvialsdayspricefastfinequicklooked

Reviews

Aug 9, 2026
my go-to for price
deborah_t279

I have ordered from a few different vendors over the past year and Element keeps winning on cost. The BPC-157 and TB-500 here run noticeably cheaper than the two other sites I used before, and the sales make it even better. Shipping has been fast and consistent on all four of my orders, usually two to three days since they ship from Texas. The only thing I would change is the packaging, it is just a plain mailer with no branding and the vials rattle around a bit. Nothing has ever broken though, and customer service answered my one stock question quickly over chat. For a budget option I have been happy and will keep reordering.

Jun 13, 2026
great chat support
Lincoln L.

Had a question about stock on retatrutide before ordering and used the live chat. Got a real answer in a couple minutes, not a canned reply. Placed the order right after and shipping was quick. Good experience all around.

Nov 21, 2025
they made it right
Garrett B.

My order was delayed and I left a grumpy review. They reached out same day, resent everything and threw in an extra vial. Customer service won me back.

Share your experience

Purchased from Element Peptides? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (7)

BPC-157$48.82
NAD+$51.96
PT-141$72.77
Semax$39.86
TB-500$26.76

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews25
Products7
Lab Tests0

Embed Badge

Element Peptides on total.reviews