E
Element Peptides
Boutique peptide vendor emphasizing small-batch quality control.
What Customers Mention
shippingvialsdayspricefastfinequicklooked
Jul 2, 2026
wrong product shipped
I ordered tirzepatide and the label on what showed up said semaglutide. Emailed them and because I was past their 30 day return window they would not do anything about it. Frustrating to be stuck with the wrong item over a return policy. Shipping was fast at least, for whatever that is worth.
Feb 3, 2026
packaging was bare bones
Just vials loose in a padded mailer, no cold pack at all. Everything arrived intact but for the price of a GLP order I expected a bit more care.
Sep 29, 2025
no reply on restock question
Emailed twice asking when retatrutide would be back and never heard a word. The first order was smooth but the silence after isn't great.
Share your experience
Purchased from Element Peptides? Help other researchers by leaving a review.
Sign in to ReviewCommunity Discussions
Ask questions and share experiences
Products (7)
BPC-157$48.82
Bacteriostatic Water$57.21
NAD+$51.96
PT-141$72.77
Semaglutide$32.61
Semax$39.86
TB-500$26.76
Vendor Info
| Status | Unclaimed |
| Website | Visit |
| Reviews | 25 |
| Products | 7 |
| Lab Tests | 0 |