Biotech Peptides

US-based manufacturer of research peptides with in-house testing.

What Customers Mention

arriveddayspricesealedfinevialsipamorelinquick

Reviews

Aug 5, 2026
replaced a cracked vial no questions
jenna_chem

One of the two BPC-157 vials arrived with a hairline crack in the box. Sent a photo to support and they shipped a replacement free the next day without making me jump through hoops. Original shipping was fast too, so a small ding handled well.

Jul 23, 2026
card only is annoying
Kelly A.

Products were fine and shipping was reasonably quick. Just wish they took something other than a credit card, felt awkward putting a research order straight on my Visa.

Jul 12, 2026
free bac water was a nice touch
Jack M.

Crossed the $200 mark on a PT-141 plus blends order and got free shipping along with a 30ml bottle of bacteriostatic water thrown in. Whole order landed in three days, vials filled correctly and the box had a cold pack that was still cool. Little extras like that are why I keep coming back instead of shopping around.

Jul 1, 2026
solid blend selection
Rebecca U.

The Sermorelin and Ipamorelin blend isn't easy to find priced this well, and the stackable discount made it an easy buy.

Jun 22, 2026
paid for AOD-9604, waited too long
Brett G.

This was a frustrating one. I ordered the AOD-9604, got the confirmation, and then heard nothing for over a week. Emailed twice with no reply before someone finally wrote back to say the item had actually been out of stock the whole time and asked if I wanted a swap or a refund. They did refund me in the end without a fight, so it wasn't a scam, but charging me for something they didn't have and going silent for days is not how this should go. The website still showed it as available too, which is the part that really bugs me.

Jun 13, 2026
support actually called me
Logan K.

Had a question about my Tesamorelin order and instead of a slow email they phoned me back the same day to sort it out. Order arrived two days after, well packed. That kind of service is rare and I'll be back.

Jun 4, 2026
fine but nothing special
Damon M.

Shipping was quick and the vials looked clean. Just middling overall, the documentation is thinner than what some other shops post.

May 27, 2026
good source, wish the COA was batch specific
Janet K.

No real complaints on the buying side here. The CJC-1295 and Ipamorelin blend came quick, packaging was tidy and the price with the BP10 code was fair. Only thing that nags me is the certificate they link is a generic one for the product, not tied to my actual lot number, so I'm taking the purity claim a little on faith.

May 18, 2026
fast as advertised
Vivian M.

Ordered the BPC-157 before noon and it shipped that same afternoon. Box was at my door two days later, vial filled right to the line.

May 9, 2026
reliable
Laura P.

Nothing flashy, just fast shipping and products that show up as described. The ipamorelin reconstituted clear. Reordering.

Apr 23, 2026
happy with it
Megan I.

Ordered the BPC-157 and TB-500 blend, arrived fast and sealed. Easy reorder process. Good experience overall.

Apr 2, 2026
price crept up
Noah B.

Been a customer a while and noticed the BPC-157 price went up since last year. Still ships fast, just not the deal it was.

Mar 19, 2026
overnight option worth it
Naomi J.

Paid for overnight shipping and it actually showed up overnight. CJC-1295 vial sealed and labeled correctly. Will order again.

Mar 5, 2026
no issues
robert_study

Three orders in, every one arrived in two to three days with vials properly sealed. Pricing on the blends is good.

Feb 18, 2026
my go-to lately
Tessa U.

Stocked when others were sold out, fast shipping, COAs on the site for most products. Hard to argue with that.

Feb 3, 2026
international shipping is slow
bryan_daily

Ordering from outside the US, took almost three weeks and a refund question dragged on. Domestic buyers probably have a better time.

Jan 21, 2026
GHK-Cu order
Chelsea J.

Good price on GHK-Cu and it shipped the same afternoon I ordered. Packaging was plain and a bit minimal but everything arrived intact.

Jan 8, 2026
fine, not amazing
Curtis D.

Decent vendor. Shipping is genuinely fast. Just wish they did independent lab testing instead of only their own.

Dec 29, 2025
customer service fixed my mixup
Richard Q.

They accidentally shipped the wrong peptide and the moment I emailed they sent the right one out, no hassle. That kind of support keeps me coming back.

Dec 15, 2025
reordering
research_michael

Quick shipping, vials sealed and labeled, price was fair. Reordering the Sermorelin and ipamorelin blend.

Share your experience

Purchased from Biotech Peptides? Help other researchers by leaving a review.

Sign in to Review

Community Discussions

Ask questions and share experiences

View All

Products (8)

Vendor Info

StatusUnclaimed
WebsiteVisit
Reviews33
Products8
Lab Tests0

Embed Badge

Biotech Peptides on total.reviews